PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010087748.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family MYB_related
Protein Properties Length: 348aa    MW: 38726.6 Da    PI: 5.8214
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010087748.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.31.7e-1360100446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +T+ E+el++++++  G++ W +Ia+ ++ gRt++++k++w++
   XP_010087748.1  60 FTPKEEELIIKLHATIGSR-WPLIAQQLP-GRTDEDVKNYWNT 100
                      9******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.65E-18898IPR009057Homeodomain-like
SMARTSM00717191049IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-41348IPR009057Homeodomain-like
PROSITE profilePS500904.0891344IPR017877Myb-like domain
PROSITE profilePS5129416.97649106IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-1849106IPR009057Homeodomain-like
SMARTSM007171.8E-1156104IPR001005SANT/Myb domain
PfamPF002492.5E-1259100IPR001005SANT/Myb domain
CDDcd001672.62E-1059102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MVRPPCSDKP NVKWSAEEDA KILEHVSKRA GLRRCGKSCK LRWTNNHLRP DLIKHDQISF  60
TPKEEELIIK LHATIGSRWP LIAQQLPGRT DEDVKNYWNT KLRKKLSGMG IDPVTHKPYS  120
QILADYGNIG GVPKSGMRIG SLNKDLKNAI LMKREAFSTP NTKPNLVSPK TEPNQDSNFL  180
NHRNQSLDLL AQLQAIKLVT EASNYPPPGL ISKEPAFSFS FAFSPSSSPV SSSSDYSTCS  240
SAAQELPPLA FNWNDFLLED AFLPSDEAQG DAKVAEFSPR NLVPESHIHT TSQDVEGPKD  300
GAGDHTVLSN DHEVNETSSC ETSFVEALLA RENEMLLEFP ELLEEAFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-191410630128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087748.10.0Myb-related protein Pp2
TrEMBLW9QDY10.0W9QDY1_9R
STRINGPOPTR_0015s07900.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.16e-50MYB family protein